Rabbit PSME3 antibody
-
Catalog number70R-1072
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProtein Modification & Stress Response
-
ImmunogenPSME3 antibody was raised using the C terminal of PSME3 corresponding to a region with amino acids TVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY
-
SpecificityPSME3 antibody was raised against the C terminal of PSME3
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PSME3 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPSME3
-
Short nameRabbit PSME3 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PSME3 antibody raised against the C terminal of PSME3
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetproteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki), HEL-S-283 and Ki and PA28-gamma and PA28G and PA28gamma and REG-GAMMA, PSME3 and IDBG-51809 and ENSG00000131467 and 10197, MDM2/MDM4 family protein binding, nuclei, Psme3 and IDBG-267041 and ENSMUSG00000078652 and 19192, PSME3 and IDBG-640458 and ENSBTAG00000019918 and 100336105
-
Gene info
-
Identity
-
Gene
-
Long gene nameproteasome activator subunit 3
-
Synonyms gene name
- proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki)
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1999-06-04
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Proteasome
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data