Rabbit PRTFDC1 antibody
-
Catalog number70R-2719
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDNA & RNA
-
ImmunogenPRTFDC1 antibody was raised using the N terminal of PRTFDC1 corresponding to a region with amino acids AGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVD
-
SpecificityPRTFDC1 antibody was raised against the N terminal of PRTFDC1
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRTFDC1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPRTFDC1
-
Short nameRabbit PRTFDC1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PRTFDC1 antibody raised against the N terminal of PRTFDC1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetphosphoribosyl transferase domain containing 1, PRTFDC1 and IDBG-63195 and ENSG00000099256 and 56952, protein homodimerization activity, Cytoplasm, PRTFDC1 and IDBG-637811 and ENSBTAG00000044011 and
-
Gene info
-
Identity
-
Gene
-
Long gene namephosphoribosyl transferase domain containing 1
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2003-11-10
-
Entrez gene record
-
RefSeq identity
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data