Rabbit PRSS16 antibody
-
Catalog number70R-6967
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProteases, Inhibitors, & Enzymes
-
ImmunogenPRSS16 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQ
-
SpecificityNA
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRSS16 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPRSS16
-
Short nameRabbit PRSS16 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PRSS16 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetprotease, serine, 16 (thymus), TSSP, PRSS16 and IDBG-70167 and ENSG00000112812 and 10279, serine-type peptidase activity, multiple, Prss16 and IDBG-134851 and ENSMUSG00000006179 and 54373, PRSS16 and IDBG-635338 and ENSBTAG00000012461 and 614489
-
Gene info
-
Identity
-
Gene
-
Long gene nameserine protease 16
-
Synonyms gene name
- protease, serine 16
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1999-12-10
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Serine proteases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data