Rabbit PRSS16 antibody

• Catalog number
  70R-6967
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Proteases, Inhibitors, & Enzymes
• Immunogen
  PRSS16 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQ
• Specificity
  NA
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRSS16 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  PRSS16  
• Gene symbol
  PRSS16
• Short name
  Rabbit PRSS16 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal PRSS16 antibody
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  protease, serine, 16 (thymus), TSSP, PRSS16 and IDBG-70167 and ENSG00000112812 and 10279, serine-type peptidase activity, multiple, Prss16 and IDBG-134851 and ENSMUSG00000006179 and 54373, PRSS16 and IDBG-635338 and ENSBTAG00000012461 and 614489

Gene info

• Identity
  HGNC:9480
• Gene
  PRSS16
• Long gene name
  serine protease 16
• Synonyms gene name
  • protease, serine 16
• Synonyms
  • TSSP
• Synonyms name
  • thymus-specific serine protease
• GenBank acession
  • AF052514
• Locus
  6p22.1
• Discovery year
  1999-12-10
• Entrez gene record
  10279
• Pubmed identfication
  • 10527559
• Classification
  • Serine proteases
• VEGA ID
  OTTHUMG00000016167

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products