Rabbit PRKRIR antibody

• Catalog number
  70R-2707
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Signal Transduction
• Immunogen
  PRKRIR antibody was raised using a synthetic peptide corresponding to a region with amino acids VENCRRADLEDKTPDQLNKHYRLCAKHFETSMICRTSPYRTVLRDNAIPT
• Specificity
  NA
• Cross Reactivity
  Human,Mouse,Rat
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRKRIR antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  PRKRIR  
• Gene symbol
  THAP12
• Short name
  Rabbit PRKRIR antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal PRKRIR antibody
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  protein-kinase, interferon-inducible double stranded RNA dependent inhibitor, repressor of (P58 repressor), DAP4 and P52rIPK and THAP0 and THAP12, PRKRIR and IDBG-65090 and ENSG00000137492 and 5612, protein dimerization activity, nuclei, Prkrir and IDBG-200491 and ENSMUSG00000030753 and 72981, PRKRIR and IDBG-635789 and ENSBTAG00000031609 and 508969

Gene info

• Identity
  HGNC:9440
• Gene
  THAP12
• Long gene name
  THAP domain containing 12
• Synonyms gene
  • PRKRIR
• Synonyms gene name
  • protein-kinase, interferon-inducible double stranded RNA dependent inhibitor, repressor of (P58 repressor)
• Synonyms
  • P52rIPK
  • DAP4
  • THAP0
• Synonyms name
  • death-associated protein 4
  • P58IPK-regulatory protein
  • 52 kDa repressor of the inhibitor of the protein kinase
• GenBank acession
  • AF007393
• Locus
  11q13.5
• Discovery year
  1998-01-30
• Entrez gene record
  5612
• Pubmed identfication
  • 9447982
  • 15863623
• RefSeq identity
  • NM_004705
• Classification
  • THAP domain containing
• VEGA ID
  OTTHUMG00000165280

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products