Rabbit PRKRA antibody
-
Catalog number70R-5897
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenPRKRA antibody was raised using the N terminal of PRKRA corresponding to a region with amino acids MSQSRHRAEAPPLEREDSGTFSLGKMITAKPGKTPIQVLHEYGMKTKNIP
-
SpecificityPRKRA antibody was raised against the N terminal of PRKRA
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRKRA antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolCHROMR, PRKRA
-
Short nameRabbit PRKRA antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PRKRA antibody raised against the N terminal of PRKRA
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetprotein kinase, interferon-inducible double stranded RNA dependent activator, DYT16 and PACT and RAX, PRKRA and IDBG-76030 and ENSG00000180228 and 8575, poly(A) RNA binding, Plasma membranes, Prkra and IDBG-182095 and ENSMUSG00000002731 and 23992, PRKRA and IDBG-640208 and ENSBTAG00000001096 and 282875
-
Gene info
-
Identity
-
Gene
-
Long gene namecholesterol induced regulator of metabolism RNA
-
Synonyms gene
-
Synonyms gene name
- PRKRA antisense RNA 1
-
Synonyms
-
Synonyms name
-
Locus
-
Discovery year2018-09-27
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Long non-coding RNAs with non-systematic symbols
Gene info
-
Identity
-
Gene
-
Long gene nameprotein activator of interferon induced protein kinase EIF2AK2
-
Synonyms gene name
- protein kinase, interferon-inducible double stranded RNA dependent activator
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1999-12-07
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data