Rabbit PRKACB antibody
-
Catalog number70R-2704
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenPRKACB antibody was raised using the middle region of PRKACB corresponding to a region with amino acids NGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDI
-
SpecificityPRKACB antibody was raised against the middle region of PRKACB
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRKACB antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPRKACB-DT, PRKACB
-
Short nameRabbit PRKACB antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PRKACB antibody raised against the middle region of PRKACB
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetprotein kinase, cAMP-dependent, catalytic, beta, PKA C-beta and PKACB, PRKACB and IDBG-99931 and ENSG00000142875 and 5567, transferase activity, nuclei, Prkacb and IDBG-199561 and ENSMUSG00000005034 and 18749, PRKACB and IDBG-637426 and ENSBTAG00000011953 and 282323
-
Gene info
-
Identity
-
Gene
-
Long gene namePRKACB divergent transcript
-
Locus
-
Discovery year2020-09-17
-
Classification
- Divergent transcripts
Gene info
-
Identity
-
Gene
-
Long gene nameprotein kinase cAMP-activated catalytic subunit beta
-
Synonyms gene name
- protein kinase, cAMP-dependent, catalytic, beta
- protein kinase, cAMP-dependent, beta catalytic subunit
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2001-06-22
-
Entrez gene record
-
RefSeq identity
-
Classification
- AGC family kinases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data