Rabbit PRKAB1 antibody

• Catalog number
  70R-3695
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Signal Transduction
• Immunogen
  PRKAB1 antibody was raised using the N terminal of PRKAB1 corresponding to a region with amino acids KILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRW
• Specificity
  PRKAB1 antibody was raised against the N terminal of PRKAB1
• Cross Reactivity
  Human,Mouse
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRKAB1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  PRKAB1  
• Gene symbol
  PRKAB1
• Short name
  Rabbit PRKAB1 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal PRKAB1 antibody raised against the N terminal of PRKAB1
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  protein kinase, AMP-activated, beta 1 non-catalytic subunit, AMPK and HAMPKb, PRKAB1 and IDBG-59969 and ENSG00000111725 and 5564, protein kinase binding, nuclei, Prkab1 and IDBG-194478 and ENSMUSG00000029513 and 19079, PRKAB1 and IDBG-633372 and ENSBTAG00000005940 and 534107

Gene info

• Identity
  HGNC:9378
• Gene
  PRKAB1
• Long gene name
  protein kinase AMP-activated non-catalytic subunit beta 1
• Synonyms gene name
  • protein kinase, AMP-activated, beta 1 non-catalytic subunit
• Synonyms name
  • AMPK beta 1
• GenBank acession
  • BC001823
• Locus
  12q24.23
• Discovery year
  1997-05-09
• Entrez gene record
  5564
• Pubmed identfication
  • 8557660
• RefSeq identity
  • NM_006253
• VEGA ID
  OTTHUMG00000168954

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products