Rabbit PRKAB1 antibody
-
Catalog number70R-3695
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenPRKAB1 antibody was raised using the N terminal of PRKAB1 corresponding to a region with amino acids KILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRW
-
SpecificityPRKAB1 antibody was raised against the N terminal of PRKAB1
-
Cross ReactivityHuman,Mouse
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRKAB1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPRKAB1
-
Short nameRabbit PRKAB1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PRKAB1 antibody raised against the N terminal of PRKAB1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetprotein kinase, AMP-activated, beta 1 non-catalytic subunit, AMPK and HAMPKb, PRKAB1 and IDBG-59969 and ENSG00000111725 and 5564, protein kinase binding, nuclei, Prkab1 and IDBG-194478 and ENSMUSG00000029513 and 19079, PRKAB1 and IDBG-633372 and ENSBTAG00000005940 and 534107
-
Gene info
-
Identity
-
Gene
-
Long gene nameprotein kinase AMP-activated non-catalytic subunit beta 1
-
Synonyms gene name
- protein kinase, AMP-activated, beta 1 non-catalytic subunit
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1997-05-09
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data