Rabbit PRKAA1 antibody
-
Catalog number70R-5929
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenPRKAA1 antibody was raised using the N terminal of PRKAA1 corresponding to a region with amino acids GELFDYICKNGRKSDVPGVVKTGSTKELDEKESRRLFQQILSGVDYCHRH
-
SpecificityPRKAA1 antibody was raised against the N terminal of PRKAA1
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRKAA1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPRKAA1
-
Short nameRabbit PRKAA1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PRKAA1 antibody raised against the N terminal of PRKAA1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetprotein kinase, AMP-activated, alpha 1 catalytic subunit, AMPK and AMPKa1, PRKAA1 and IDBG-18226 and ENSG00000132356 and 5562, transferase activity, nuclei, Prkaa1 and IDBG-128002 and ENSMUSG00000050697 and 105787, PRKAA1 and IDBG-629895 and ENSBTAG00000000013 and 540404
-
Gene info
-
Identity
-
Gene
-
Long gene nameprotein kinase AMP-activated catalytic subunit alpha 1
-
Synonyms gene name
- protein kinase, AMP-activated, alpha 1 catalytic subunit
-
Synonyms
-
Synonyms name
-
Locus
-
Discovery year1997-05-09
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data