Rabbit PRDX5 antibody

• Catalog number
  70R-5755
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Signal Transduction
• Immunogen
  PRDX5 antibody was raised using the middle region of PRDX5 corresponding to a region with amino acids TDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNI
• Specificity
  PRDX5 antibody was raised against the middle region of PRDX5
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRDX5 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  PRDX5  
• Gene symbol
  PRDX5
• Short name
  Rabbit PRDX5 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal PRDX5 antibody raised against the middle region of PRDX5
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  peroxiredoxin 5, ACR1 and AOEB166 and B166 and HEL-S-55 and PLP and PMP20 and PRDX6 and prx-V and PRXV, PRDX5 and IDBG-53649 and ENSG00000126432 and 25824, peroxynitrite reductase activity, nuclei, Prdx5 and IDBG-136962 and ENSMUSG00000024953 and 54683, PRDX5 and IDBG-643929 and ENSBTAG00000008648 and 282885

Gene info

• Identity
  HGNC:9355
• Gene
  PRDX5
• Long gene name
  peroxiredoxin 5
• Synonyms
  • ACR1
  • AOEB166
  • MGC142285
  • PRXV
  • PMP20
  • B166
  • PRDX6
  • PLP
  • SBBI10
  • MGC117264
  • MGC142283
• Synonyms name
  • antioxidant enzyme B166
  • thioredoxin peroxidase PMP20
  • peroxisomal antioxidant enzyme
  • TPx type VI
  • liver tissue 2D-page spot 71B
  • Alu co-repressor 1
• GenBank acession
  • AF197952
• Locus
  11q13.1
• Discovery year
  2000-07-31
• Entrez gene record
  25824
• Pubmed identfication
  • 10514471
  • 10521424
• RefSeq identity
  • NM_181651
• Classification
  • Peroxiredoxins
• VEGA ID
  OTTHUMG00000168805

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products