Rabbit PRDX1 antibody
-
Catalog number70R-2253
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenPRDX1 antibody was raised using the N terminal of PRDX1 corresponding to a region with amino acids SSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFV
-
SpecificityPRDX1 antibody was raised against the N terminal of PRDX1
-
Cross ReactivityHuman,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRDX1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPRDX1
-
Short nameRabbit PRDX1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PRDX1 antibody raised against the N terminal of PRDX1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetperoxiredoxin 1, MSP23 and NKEF-A and NKEFA and PAG and PAGA and PAGB and PRX1 and PRXI and TDPX2, PRDX1 and IDBG-97953 and ENSG00000117450 and 5052, peroxiredoxin activity, nuclei, Prdx1 and IDBG-178542 and ENSMUSG00000028691 and 18477, PRDX1 and IDBG-640075 and ENSBTAG00000003642 and 281997
-
Gene info
-
Identity
-
Gene
-
Long gene nameperoxiredoxin 1
-
Synonyms gene
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1993-11-01
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Peroxiredoxins
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data