Rabbit PRAME antibody
-
Catalog number70R-2630
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Cycle & Cell Death
-
ImmunogenPRAME antibody was raised using the N terminal of PRAME corresponding to a region with amino acids MERRRLWGSIQSRYISMSVWTSPRRLVELAGQSLLKDEALAIAALELLPR
-
SpecificityPRAME antibody was raised against the N terminal of PRAME
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRAME antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPRAME
-
Short nameRabbit PRAME antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PRAME antibody raised against the N terminal of PRAME
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetpreferentially expressed antigen in melanoma, CT130 and MAPE and OIP-4 and OIP4, PRAME and IDBG-2240 and ENSG00000185686 and 23532, retinoic acid receptor binding, nuclei
-
Gene info
-
Identity
-
Gene
-
Long gene namePRAME nuclear receptor transcriptional regulator
-
Synonyms gene
-
Synonyms gene name
- preferentially expressed antigen in melanoma
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1996-06-21
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- PRAME family
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data