Rabbit PPP2R5C antibody

• Catalog number
  70R-2037
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Signal Transduction
• Immunogen
  PPP2R5C antibody was raised using the middle region of PPP2R5C corresponding to a region with amino acids RFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGK
• Specificity
  PPP2R5C antibody was raised against the middle region of PPP2R5C
• Cross Reactivity
  Human,Mouse,Rat
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPP2R5C antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  PPP2R5C  
• Gene symbol
  PPP2R5C
• Short name
  Rabbit PPP2R5C antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal PPP2R5C antibody raised against the middle region of PPP2R5C
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  protein phosphatase 2, regulatory subunit B', gamma, B56G and PR61G, PPP2R5C and IDBG-20535 and ENSG00000078304 and 5527, protein phosphatase type 2A regulator activity, nuclei, Ppp2r5c and IDBG-171384 and ENSMUSG00000017843 and 26931, PPP2R5C and IDBG-634666 and ENSBTAG00000020192 and 505757

Gene info

• Identity
  HGNC:9311
• Gene
  PPP2R5C
• Long gene name
  protein phosphatase 2 regulatory subunit B'gamma
• Synonyms gene name
  • protein phosphatase 2, regulatory subunit B (B56), gamma isoform
• Synonyms
  • B56G
  • PR61G
  • B56gamma
• GenBank acession
  • L42375
• Locus
  14q32.31
• Discovery year
  1996-05-08
• Entrez gene record
  5527
• Pubmed identfication
  • 7592815
• RefSeq identity
  • NM_002719
• Classification
  • Protein phosphatase 2 regulatory subunits
  • Armadillo like helical domain containing
• VEGA ID
  OTTHUMG00000171597

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products