Rabbit PPIF antibody
-
Catalog number70R-1119
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProtein Modification & Stress Response
-
ImmunogenPPIF antibody was raised using a synthetic peptide corresponding to a region with amino acids GSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLS
-
SpecificityNA
-
Cross ReactivityHuman,Rat,Dog
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PPIF antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPPIF
-
Short nameRabbit PPIF antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PPIF antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetpeptidylprolyl isomerase F, Cyp-D and CyP-M and CYP3 and CypD, PPIF and IDBG-79997 and ENSG00000108179 and 10105, peptide binding, Plasma membranes, Ppif and IDBG-138877 and ENSMUSG00000021868 and 105675, PPIF and IDBG-630958 and ENSBTAG00000016711 and 414346
-
Gene info
-
Identity
-
Gene
-
Long gene namepeptidylprolyl isomerase F
-
Synonyms gene name
- peptidylprolyl isomerase F (cyclophilin F)
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1999-06-02
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Cyclophilin peptidylprolyl isomerases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data