Rabbit PPIE antibody

• Catalog number
  70R-1435
• Price
  Please ask
• Size
  100 ug

• Applications
  WB, IHC
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Protein Modification & Stress Response
• Immunogen
  PPIE antibody was raised using a synthetic peptide corresponding to a region with amino acids KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKP
• Specificity
  NA
• Cross Reactivity
  Human,Dog
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PPIE antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  PPIE  
• Gene symbol
  PPIE
• Short name
  Rabbit PPIE antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal PPIE antibody
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  peptidylprolyl isomerase E (cyclophilin E), CYP-33 and CYP33, PPIE and IDBG-96746 and ENSG00000084072 and 10450, poly(A) RNA binding, nuclei, Ppie and IDBG-184920 and ENSMUSG00000028651 and 56031, BT.21742 and IDBG-640866 and ENSBTAG00000047314 and 100296550,787681

Gene info

• Identity
  HGNC:9258
• Gene
  PPIE
• Long gene name
  peptidylprolyl isomerase E
• Synonyms
  • CyP-33
  • MGC3736
  • MGC111222
• Synonyms name
  • peptidyl-prolyl cis-trans isomerase E
  • cyclophilin 33
  • cyclophilin E
  • PPIase E
  • rotamase E
  • peptidylprolyl isomerase E, isoform 1
• GenBank acession
  • AF042385
• Locus
  1p34.2
• Discovery year
  1999-07-07
• Entrez gene record
  10450
• Pubmed identfication
  • 9747881
• RefSeq identity
  • NM_006112
• Classification
  • Cyclophilin peptidylprolyl isomerases
  • Spliceosomal C complex
  • Spliceosomal B complex
  • Spliceosomal Bact complex
  • Spliceosomal P complex
  • RNA binding motif containing
• VEGA ID
  OTTHUMG00000009248
• Locus Specific Databases
  • LRG_1053

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products