Rabbit PPID antibody

  • Catalog number
    70R-4331
  • Price
    Please ask
  • Size
    50 ug
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Protein Modification & Stress Response
  • Immunogen
    PPID antibody was raised using a synthetic peptide corresponding to a region with amino acids CPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSM
  • Specificity
    NA
  • Cross Reactivity
    Human, Mouse, Rat
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPID antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • French translation
    anticorps
  • Gene target
    PPID  
  • Gene symbol
    PPID
  • Short name
    Rabbit PPID antibody
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Host
    Rabbit, Rabbits
  • Isotype
    NA
  • Alternative name
    Rabbit polyclonal PPID antibody
  • Alternative technique
    antibodies, rabbit-anti
  • Alternative to gene target
    peptidylprolyl isomerase D, CYP-40 and CYPD, PPID and IDBG-43002 and ENSG00000171497 and 5481, Hsp90 protein binding, nuclei, Ppid and IDBG-153114 and ENSMUSG00000027804 and 67738, PPID and IDBG-630512 and ENSBTAG00000016680 and 281420
Gene info
  • Identity
  • Gene
  • Long gene name
    peptidylprolyl isomerase D
  • Synonyms gene name
    • peptidylprolyl isomerase D (cyclophilin D)
  • Synonyms
  • Synonyms name
  • Locus
  • Discovery year
    1995-08-23
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Cyclophilin peptidylprolyl isomerases
    • Tetratricopeptide repeat domain containing
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee