Rabbit PPAP2A antibody

  • Catalog number
    70R-1660
  • Price
    Please ask
  • Size
    100 ug
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Signal Transduction
  • Immunogen
    PPAP2A antibody was raised using the middle region of PPAP2A corresponding to a region with amino acids DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL
  • Specificity
    PPAP2A antibody was raised against the middle region of PPAP2A
  • Cross Reactivity
    Human,Mouse,ZebraFish
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PPAP2A antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • French translation
    anticorps
  • Gene target
    PPAP2A  
  • Gene symbol
    PLPP1
  • Short name
    Rabbit PPAP2A antibody
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Host
    Rabbit, Rabbits
  • Isotype
    NA
  • Alternative name
    Rabbit polyclonal PPAP2A antibody raised against the middle region of PPAP2A
  • Alternative technique
    antibodies, rabbit-anti
  • Alternative to gene target
    phosphatidic acid phosphatase type 2A, LLP1a and LPP1 and PAP-2a and PAP2, PPAP2A and IDBG-21171 and ENSG00000067113 and 8611, phosphatidate phosphatase activity, Plasma membranes, Ppap2a and IDBG-183015 and ENSMUSG00000021759 and 19012, PPAP2A and IDBG-629135 and ENSBTAG00000010526 and 617172
Gene info
  • Identity
  • Gene
  • Long gene name
    phospholipid phosphatase 1
  • Synonyms gene
  • Synonyms gene name
    • phosphatidic acid phosphatase type 2A
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1998-12-02
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • MicroRNA protein coding host genes
    • Phospholipid phosphatases
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee