Rabbit PPAP2A antibody
-
Catalog number70R-1660
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenPPAP2A antibody was raised using the middle region of PPAP2A corresponding to a region with amino acids DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL
-
SpecificityPPAP2A antibody was raised against the middle region of PPAP2A
-
Cross ReactivityHuman,Mouse,ZebraFish
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PPAP2A antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPLPP1
-
Short nameRabbit PPAP2A antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PPAP2A antibody raised against the middle region of PPAP2A
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetphosphatidic acid phosphatase type 2A, LLP1a and LPP1 and PAP-2a and PAP2, PPAP2A and IDBG-21171 and ENSG00000067113 and 8611, phosphatidate phosphatase activity, Plasma membranes, Ppap2a and IDBG-183015 and ENSMUSG00000021759 and 19012, PPAP2A and IDBG-629135 and ENSBTAG00000010526 and 617172
-
Gene info
-
Identity
-
Gene
-
Long gene namephospholipid phosphatase 1
-
Synonyms gene
-
Synonyms gene name
- phosphatidic acid phosphatase type 2A
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1998-12-02
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- MicroRNA protein coding host genes
- Phospholipid phosphatases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data