Rabbit POSTN antibody
-
Catalog number70R-6066
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenPOSTN antibody was raised using the N terminal of POSTN corresponding to a region with amino acids RAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEAL
-
SpecificityPOSTN antibody was raised against the N terminal of POSTN
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of POSTN antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPOSTN
-
Short nameRabbit POSTN antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal POSTN antibody raised against the N terminal of POSTN
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetperiostin, osteoblast specific factor, OSF-2 and OSF2 and PDLPOSTN and periostin and PN, POSTN and IDBG-24971 and ENSG00000133110 and 10631, heparin binding, Extracellular, Postn and IDBG-144426 and ENSMUSG00000027750 and 50706, POSTN and IDBG-629835 and ENSBTAG00000012409 and 281960
-
Gene info
-
Identity
-
Gene
-
Long gene nameperiostin
-
Synonyms gene name
- periostin, osteoblast specific factor
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2004-02-10
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Gla domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data