Rabbit POLR3B antibody
-
Catalog number70R-2297
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDNA & RNA
-
ImmunogenPOLR3B antibody was raised using the C terminal of POLR3B corresponding to a region with amino acids IEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQED
-
SpecificityPOLR3B antibody was raised against the C terminal of POLR3B
-
Cross ReactivityHuman, Mouse, Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of POLR3B antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPOLR3B
-
Short nameRabbit POLR3B antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal POLR3B antibody raised against the C terminal of POLR3B
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetpolymerase (RNA) III (DNA directed) polypeptide B, POLR3B and IDBG-54798 and ENSG00000013503 and 55703, metal ion binding, nuclei, Polr3b and IDBG-180612 and ENSMUSG00000034453 and 70428, BT.42818 and IDBG-637665 and ENSBTAG00000004781 and 540839
-
Gene info
-
Identity
-
Gene
-
Long gene nameRNA polymerase III subunit B
-
Synonyms gene name
- polymerase (RNA) III (DNA directed) polypeptide B
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2004-04-21
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- RNA polymerase subunits
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data