Rabbit PIM1 antibody
-
Catalog number70R-2105
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDNA & RNA
-
ImmunogenPIM1 antibody was raised using the N terminal of PIM1 corresponding to a region with amino acids MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFG
-
SpecificityPIM1 antibody was raised against the N terminal of PIM1
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PIM1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPIM1, LONP1
-
Short nameRabbit PIM1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PIM1 antibody raised against the N terminal of PIM1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetpim-1 oncogene, PIM, PIM1 and IDBG-85488 and ENSG00000137193 and 5292, transferase activity, nuclei, Pim1 and IDBG-160725 and ENSMUSG00000024014 and 18712, PIM1 and IDBG-630304 and ENSBTAG00000000396 and 281402
-
Gene info
-
Identity
-
Gene
-
Long gene namePim-1 proto-oncogene, serine/threonine kinase
-
Synonyms gene
-
Synonyms gene name
- pim-1 oncogene
-
Locus
-
Discovery year1986-01-01
-
Entrez gene record
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene namelon peptidase 1, mitochondrial
-
Synonyms gene
-
Synonyms gene name
- protease, serine, 15
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1999-09-17
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Serine proteases
- AAA ATPases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data