Rabbit PIGT antibody

• Catalog number
  70R-7466
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Cell Biology
• Immunogen
  PIGT antibody was raised using the C terminal of PIGT corresponding to a region with amino acids LPANSVTKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPSMVAAKP
• Specificity
  PIGT antibody was raised against the C terminal of PIGT
• Cross Reactivity
  Human,Mouse,Rat
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PIGT antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  PIGT  
• Gene symbol
  PIGT
• Short name
  Rabbit PIGT antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal PIGT antibody raised against the C terminal of PIGT
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  phosphatidylinositol glycan anchor biosynthesis, class T, PIGT and IDBG-77636 and ENSG00000124155 and 51604, protein binding, Plasma membranes, Pigt and IDBG-212207 and ENSMUSG00000017721 and 78928, PIGT and IDBG-642899 and ENSBTAG00000016122 and 504724

Gene info

• Identity
  HGNC:14938
• Gene
  PIGT
• Long gene name
  phosphatidylinositol glycan anchor biosynthesis class T
• Synonyms gene name
  • phosphatidylinositol glycan, class T
• Synonyms name
  • GPI transamidase subunit
• Locus
  20q13.12
• Discovery year
  2001-03-27
• Entrez gene record
  51604
• Pubmed identfication
  • 15713669
• RefSeq identity
  • NM_015937
• Classification
  • Phosphatidylinositol glycan anchor biosynthesis
  • Glycosylphosphatidylinositol transamidase complex
  • MicroRNA protein coding host genes
• VEGA ID
  OTTHUMG00000032574

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products