Rabbit PHLDA3 antibody
-
Catalog number70R-4228
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenPHLDA3 antibody was raised using the N terminal of PHLDA3 corresponding to a region with amino acids LQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRC
-
SpecificityPHLDA3 antibody was raised against the N terminal of PHLDA3
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PHLDA3 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPHLDA3
-
Short nameRabbit PHLDA3 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PHLDA3 antibody raised against the N terminal of PHLDA3
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetpleckstrin homology-like domain, family A, member 3, TIH1, PHLDA3 and IDBG-105766 and ENSG00000174307 and 23612, phosphatidylinositol-4, Plasma membranes, Phlda3 and IDBG-195037 and ENSMUSG00000041801 and 27280
-
Gene info
-
Identity
-
Gene
-
Long gene namepleckstrin homology like domain family A member 3
-
Synonyms gene name
- pleckstrin homology-like domain, family A, member 3
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1999-10-19
-
Entrez gene record
-
RefSeq identity
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data