Rabbit PHLDA2 antibody

• Catalog number
  70R-6017
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Signal Transduction
• Immunogen
  PHLDA2 antibody was raised using the middle region of PHLDA2 corresponding to a region with amino acids QNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRT
• Specificity
  PHLDA2 antibody was raised against the middle region of PHLDA2
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PHLDA2 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  PHLDA2  
• Gene symbol
  PHLDA2
• Short name
  Rabbit PHLDA2 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal PHLDA2 antibody raised against the middle region of PHLDA2
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  pleckstrin homology-like domain, family A, member 2, BRW1C and BWR1C and HLDA2 and IPL and TSSC3, PHLDA2 and IDBG-23772 and ENSG00000181649 and 7262, Plasma membranes, Phlda2 and IDBG-212749 and ENSMUSG00000010760 and 22113, PHLDA2 and IDBG-645159 and ENSBTAG00000031194 and 618810

Gene info

• Identity
  HGNC:12385
• Gene
  PHLDA2
• Long gene name
  pleckstrin homology like domain family A member 2
• Synonyms gene
  • TSSC3
• Synonyms gene name
  • tumor suppressing subtransferable candidate 3
  • pleckstrin homology-like domain, family A, member 2
• Synonyms
  • IPL
  • BWR1C
  • HLDA2
• GenBank acession
  • AF035444
• Locus
  11p15.4
• Discovery year
  1998-06-22
• Entrez gene record
  7262
• Pubmed identfication
  • 9328465
  • 9403053
• RefSeq identity
  • NM_003311
• Classification
  • Pleckstrin homology domain containing
• VEGA ID
  OTTHUMG00000010926
• Locus Specific Databases
  • LRG_1043

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products