Rabbit PHLDA1 antibody
-
Catalog number70R-2176
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenPHLDA1 antibody was raised using the middle region of PHLDA1 corresponding to a region with amino acids PAVASLEPPVKLKELHFSNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCP
-
SpecificityPHLDA1 antibody was raised against the middle region of PHLDA1
-
Cross ReactivityHuman,Mouse
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PHLDA1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPHLDA1-DT, PHLDA1-AS1, PHLDA1
-
Short nameRabbit PHLDA1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PHLDA1 antibody raised against the middle region of PHLDA1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetpleckstrin homology-like domain, family A, member 1, DT1P1B11 and PHRIP and TDAG51, PHLDA1 and IDBG-48878 and ENSG00000139289 and 22822, protein binding, nuclei, Phlda1 and IDBG-190194 and ENSMUSG00000020205 and 21664, PHLDA1 and IDBG-629993 and ENSBTAG00000034985 and 540135
-
Gene info
-
Identity
-
Gene
-
Long gene namePHLDA1 divergent transcript
-
Locus
-
Discovery year2021-03-10
-
Classification
- Divergent transcripts
Gene info
-
Identity
-
Gene
-
Long gene namePHLDA1 antisense RNA 1
-
Locus
-
Discovery year2021-02-08
-
Pubmed identfication
-
Classification
- Antisense RNAs
Gene info
-
Identity
-
Gene
-
Long gene namepleckstrin homology like domain family A member 1
-
Synonyms gene name
- pleckstrin homology-like domain, family A, member 1
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1999-10-19
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data