Rabbit PHLDA1 antibody

  • Catalog number
    70R-2176
  • Price
    Please ask
  • Size
    50 ug
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Signal Transduction
  • Immunogen
    PHLDA1 antibody was raised using the middle region of PHLDA1 corresponding to a region with amino acids PAVASLEPPVKLKELHFSNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCP
  • Specificity
    PHLDA1 antibody was raised against the middle region of PHLDA1
  • Cross Reactivity
    Human,Mouse
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PHLDA1 antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • French translation
    anticorps
  • Gene target
    PHLDA1  
  • Gene symbol
    PHLDA1-DT, PHLDA1-AS1, PHLDA1
  • Short name
    Rabbit PHLDA1 antibody
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Host
    Rabbit, Rabbits
  • Isotype
    NA
  • Alternative name
    Rabbit polyclonal PHLDA1 antibody raised against the middle region of PHLDA1
  • Alternative technique
    antibodies, rabbit-anti
  • Alternative to gene target
    pleckstrin homology-like domain, family A, member 1, DT1P1B11 and PHRIP and TDAG51, PHLDA1 and IDBG-48878 and ENSG00000139289 and 22822, protein binding, nuclei, Phlda1 and IDBG-190194 and ENSMUSG00000020205 and 21664, PHLDA1 and IDBG-629993 and ENSBTAG00000034985 and 540135
Gene info
  • Identity
  • Gene
  • Long gene name
    PHLDA1 divergent transcript
  • Locus
  • Discovery year
    2021-03-10
  • Classification
    • Divergent transcripts
Gene info
  • Identity
  • Gene
  • Long gene name
    PHLDA1 antisense RNA 1
  • Locus
  • Discovery year
    2021-02-08
  • Pubmed identfication
  • Classification
    • Antisense RNAs
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee