Rabbit PELI1 antibody

• Catalog number
  70R-3450
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Signal Transduction
• Immunogen
  PELI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAA
• Specificity
  NA
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PELI1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  PELI1  
• Gene symbol
  PELI1
• Short name
  Rabbit PELI1 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal PELI1 antibody
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  pellino E3 ubiquitin protein ligase 1, PELI1 and IDBG-53855 and ENSG00000197329 and 57162, ligase activity, nuclei, Peli1 and IDBG-153059 and ENSMUSG00000020134 and 67245, PELI1 and IDBG-635528 and ENSBTAG00000020865 and 535054

Gene info

• Identity
  HGNC:8827
• Gene
  PELI1
• Long gene name
  pellino E3 ubiquitin protein ligase 1
• Synonyms gene name
  • pellino (Drosophila) homolog 1
  • pellino homolog 1 (Drosophila)
• Locus
  2p14
• Discovery year
  2000-09-01
• Entrez gene record
  57162
• Pubmed identfication
  • 11306823
  • 16951688
• RefSeq identity
  • NM_020651
• Classification
  • Pellino E3 ubiquitin protein ligases
• VEGA ID
  OTTHUMG00000129511

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products