Rabbit PEA15 antibody
-
Catalog number70R-6028
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaNeuroscience
-
ImmunogenPEA15 antibody was raised using the middle region of PEA15 corresponding to a region with amino acids DLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKL
-
SpecificityPEA15 antibody was raised against the middle region of PEA15
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PEA15 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPEA15
-
Short nameRabbit PEA15 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PEA15 antibody raised against the middle region of PEA15
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetphosphoprotein enriched in astrocytes 15, HMAT1 and HUMMAT1H and MAT1 and MAT1H and PEA-15 and PED, PEA15 and IDBG-104008 and ENSG00000162734 and 8682, protein binding, Cytoplasm, Pea15a and IDBG-205249 and ENSMUSG00000013698 and 18611, PEA15 and IDBG-630628 and ENSBTAG00000005793 and 510586
-
Gene info
-
Identity
-
Gene
-
Long gene nameproliferation and apoptosis adaptor protein 15
-
Synonyms gene name
- phosphoprotein enriched in astrocytes 15
- proliferation and apoptosis adaptor 15
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1998-11-06
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Death effector domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data