Rabbit PDE3B antibody
-
Catalog number70R-6283
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenPDE3B antibody was raised using the middle region of PDE3B corresponding to a region with amino acids SRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVN
-
SpecificityPDE3B antibody was raised against the middle region of PDE3B
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDE3B antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPDE3B
-
Short nameRabbit PDE3B antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PDE3B antibody raised against the middle region of PDE3B
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetphosphodiesterase 3B, cGMP-inhibited, cGIPDE1 and HcGIP1, PDE3B and IDBG-33215 and ENSG00000152270 and 5140, 3', Plasma membranes, Pde3b and IDBG-207234 and ENSMUSG00000030671 and 18576, PDE3B and IDBG-632846 and ENSBTAG00000005218 and 533323
-
Gene info
-
Identity
-
Gene
-
Long gene namephosphodiesterase 3B
-
Synonyms gene name
- phosphodiesterase 3B, cGMP-inhibited
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1995-10-02
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Phosphodiesterases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data