Rabbit PDE3A antibody
-
Catalog number70R-6279
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenPDE3A antibody was raised using the N terminal of PDE3A corresponding to a region with amino acids LLADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSD
-
SpecificityPDE3A antibody was raised against the N terminal of PDE3A
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDE3A antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPDE3A-AS1, PDE3A
-
Short nameRabbit PDE3A antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PDE3A antibody raised against the N terminal of PDE3A
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetphosphodiesterase 3A, cGMP-inhibited, CGI-PDE and CGI-PDE A and CGI-PDE-A, PDE3A and IDBG-22315 and ENSG00000172572 and 5139, 3', Plasma membranes, Pde3a and IDBG-196288 and ENSMUSG00000041741 and 54611, PDE3A and IDBG-639031 and ENSBTAG00000017260 and 536636
-
Gene info
-
Identity
-
Gene
-
Long gene namePDE3A antisense RNA 1
-
Locus
-
Discovery year2021-03-11
-
Classification
- Antisense RNAs
Gene info
-
Identity
-
Gene
-
Long gene namephosphodiesterase 3A
-
Synonyms gene name
- phosphodiesterase 3A, cGMP-inhibited
-
Synonyms
-
Synonyms name
-
Locus
-
Discovery year1994-07-29
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Phosphodiesterases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data