Rabbit PCSK5 antibody
-
Catalog number70R-5352
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenPCSK5 antibody was raised using the middle region of PCSK5 corresponding to a region with amino acids CAGAGADGCINCTEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDIS
-
SpecificityPCSK5 antibody was raised against the middle region of PCSK5
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCSK5 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPCSK5
-
Short nameRabbit PCSK5 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PCSK5 antibody raised against the middle region of PCSK5
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetproprotein convertase subtilisin/kexin type 5, PC5 and PC6 and PC6A and SPC6, PCSK5 and IDBG-71797 and ENSG00000099139 and 5125, peptide binding, Extracellular, Pcsk5 and IDBG-150930 and ENSMUSG00000024713 and 18552, PCSK5 and IDBG-632432 and ENSBTAG00000008101 and 528098
-
Gene info
-
Identity
-
Gene
-
Long gene nameproprotein convertase subtilisin/kexin type 5
-
Synonyms
-
Locus
-
Discovery year1993-10-19
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Proprotein convertase subtilisin/kexin family
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data