Rabbit PCDH15 antibody

• Catalog number
  70R-6995
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Cell Biology
• Immunogen
  PCDH15 antibody was raised using the N terminal of PCDH15 corresponding to a region with amino acids HSIVVQVQCINKKVGTIIYHEVRIVVRDRNDNSPTFKHESYYATVNELTP
• Specificity
  PCDH15 antibody was raised against the N terminal of PCDH15
• Cross Reactivity
  Human,Mouse,Rat
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCDH15 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  PCDH15  
• Gene symbol
  PCDH15
• Short name
  Rabbit PCDH15 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal PCDH15 antibody raised against the N terminal of PCDH15
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  protocadherin-related 15, PCDH15 and IDBG-74763 and ENSG00000150275 and 65217, protein binding, Extracellular, Pcdh15 and IDBG-162009 and ENSMUSG00000052613 and 11994, PCDH15 and IDBG-637041 and ENSBTAG00000045905 and 100140108

Gene info

• Identity
  HGNC:14674
• Gene
  PCDH15
• Long gene name
  protocadherin related 15
• Synonyms gene
  • USH1F
  • DFNB23
• Synonyms gene name
  • deafness, autosomal recessive 23
  • protocadherin 15
• Synonyms
  • CDHR15
• Synonyms name
  • cadherin-related family member 15
• GenBank acession
  • AY029205
• Locus
  10q21.1
• Discovery year
  2001-02-27
• Entrez gene record
  65217
• Pubmed identfication
  • 11398101
  • 14570705
• RefSeq identity
  • NM_033056
• Classification
  • Cadherin related
  • MicroRNA protein coding host genes
• VEGA ID
  OTTHUMG00000018259
• Locus Specific Databases
  • Mutations of the Protocadherin 15 Gene
  • CCHMC-BMI & UC Hearing Loss Mutation Database

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products