Rabbit PCBP3 antibody
-
Catalog number70R-4780
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDNA & RNA
-
ImmunogenPCBP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTI
-
SpecificityNA
-
Cross ReactivityHuman,Mouse
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCBP3 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPCBP3, PCBP3-AS1
-
Short nameRabbit PCBP3 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PCBP3 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Gene info
-
Identity
-
Gene
-
Long gene namepoly(rC) binding protein 3
-
Synonyms gene
-
Synonyms gene name
- poly(rC)-binding protein 3
- PCBP3 overlapping transcript 1
- poly(rC) binding protein 3 overlapping transcript
- PCBP3 overlapping transcript (non-protein coding)
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2000-05-23
-
Entrez gene record
-
Pubmed identfication
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene namePCBP3 antisense RNA 1
-
Locus
-
Discovery year2019-09-19
-
Entrez gene record
-
RefSeq identity
-
Classification
- Antisense RNAs
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data