Rabbit P2RY12 antibody
#
-
Catalog number70R-7094
-
Price:
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenP2RY12 antibody was raised using the N terminal of P2RY12 corresponding to a region with amino acids VAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG
-
SpecificityP2RY12 antibody was raised against the N terminal of P2RY12
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of P2RY12 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolP2RY12
-
Short nameRabbit P2RY12 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal P2RY12 antibody raised against the N terminal of P2RY12
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetpurinergic receptor P2Y, G-protein coupled, 12, P2RY12 and IDBG-61579 and ENSG00000169313 and 64805, guanyl-nucleotide exchange factor activity, Cell surfaces, P2ry12 and IDBG-147152 and ENSMUSG00000036353 and 70839, P2RY12 and IDBG-637609 and ENSBTAG00000015837 and 408007
-
Gene info
-
Identity
-
Gene
-
Long gene namepurinergic receptor P2Y12
-
Synonyms gene name
- purinergic receptor P2Y, G-protein coupled, 12
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2002-12-10
-
Pubmed identfication
-
Classification
- P2Y receptors
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data