Rabbit P2RX7 antibody
-
Catalog number70R-1514
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB, IHC
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaImmunology
-
ImmunogenP2RX7 antibody was raised using the N terminal of P2RX7 corresponding to a region with amino acids IQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISSVHTKVKGIAE
-
SpecificityP2RX7 antibody was raised against the N terminal of P2RX7
-
Cross ReactivityHuman, Mouse
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of P2RX7 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolP2RX7
-
Short nameRabbit P2RX7 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal P2RX7 antibody raised against the N terminal of P2RX7
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetpurinergic receptor P2X, ligand-gated ion channel, 7, P2X7, P2RX7 and IDBG-61253 and ENSG00000089041 and 5027, scaffold protein binding, nuclei, P2rx7 and IDBG-198410 and ENSMUSG00000029468 and 18439, P2RX7 and IDBG-633042 and ENSBTAG00000008948 and 286814
-
Gene info
-
Identity
-
Gene
-
Long gene namepurinergic receptor P2X 7
-
Synonyms gene name
- purinergic receptor P2X, ligand-gated ion channel, 7
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1997-10-09
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Purinergic receptors P2X
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data