Rabbit P2RX4 antibody
-
Catalog number70R-5172
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaNeuroscience
-
ImmunogenP2RX4 antibody was raised using the N terminal of P2RX4 corresponding to a region with amino acids VQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIW
-
SpecificityP2RX4 antibody was raised against the N terminal of P2RX4
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of P2RX4 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolP2RX4
-
Short nameRabbit P2RX4 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal P2RX4 antibody raised against the N terminal of P2RX4
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetpurinergic receptor P2X, ligand-gated ion channel, 4, P2X4 and P2X4R, P2RX4 and IDBG-61373 and ENSG00000135124 and 5025, cadherin binding, nuclei, P2rx4 and IDBG-198527 and ENSMUSG00000029470 and 18438, P2RX4 and IDBG-633036 and ENSBTAG00000010812 and 338036
-
Gene info
-
Identity
-
Gene
-
Long gene namepurinergic receptor P2X 4
-
Synonyms gene name
- purinergic receptor P2X, ligand-gated ion channel, 4
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1997-10-09
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Purinergic receptors P2X
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data