Rabbit OSMR antibody
-
Catalog number70R-7384
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCytokines & Growth Factors
-
ImmunogenOSMR antibody was raised using the N terminal of OSMR corresponding to a region with amino acids YQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQ
-
SpecificityOSMR antibody was raised against the N terminal of OSMR
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OSMR antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolOSMR-DT, OSMR
-
Short nameRabbit OSMR antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal OSMR antibody raised against the N terminal of OSMR
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetoncostatin M receptor, OSMRB and PLCA1, OSMR and IDBG-17615 and ENSG00000145623 and 9180, growth factor binding, multiple, Osmr and IDBG-128241 and ENSMUSG00000022146 and 18414, BT.103407 and IDBG-629972 and ENSBTAG00000033107 and 514720
-
Gene info
-
Identity
-
Gene
-
Long gene nameOSMR divergent transcript
-
Synonyms gene
-
Synonyms gene name
- OSMR antisense RNA 1 (head to head)
-
Locus
-
Discovery year2014-04-03
-
Entrez gene record
-
RefSeq identity
-
Classification
- Divergent transcripts
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameoncostatin M receptor
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1999-02-17
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Fibronectin type III domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data