Rabbit OMG antibody
-
Catalog number70R-6385
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaNeuroscience
-
ImmunogenOMG antibody was raised using the middle region of OMG corresponding to a region with amino acids NTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTN
-
SpecificityOMG antibody was raised against the middle region of OMG
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OMG antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolOMG
-
Short nameRabbit OMG antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal OMG antibody raised against the middle region of OMG
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetoli this GO dendrocyte myelin glycoprotein, OMGP, OMG and IDBG-39625 and ENSG00000126861 and 101927057,4974, identical protein binding, Plasma membranes, Omg and IDBG-203586 and ENSMUSG00000049612 and 18377, OMG and IDBG-631376 and ENSBTAG00000025213 and 407186
-
Gene info
-
Identity
-
Gene
-
Long gene nameoligodendrocyte myelin glycoprotein
-
Synonyms
-
Locus
-
Discovery year1991-06-05
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data