Rabbit NUSAP1 antibody
-
Catalog number70R-2155
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenNUSAP1 antibody was raised using the middle region of NUSAP1 corresponding to a region with amino acids AENAVSSGNRDSKVPSEGKKSLYTDESSKPGKNKRTAITTPNFKKLHEAH
-
SpecificityNUSAP1 antibody was raised against the middle region of NUSAP1
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NUSAP1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolNUSAP1
-
Short nameRabbit NUSAP1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal NUSAP1 antibody raised against the middle region of NUSAP1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetnucleolar and spindle associated protein 1, NUSAP1 and IDBG-7026 and ENSG00000137804 and 51203, poly(A) RNA binding, nuclei, Nusap1 and IDBG-199765 and ENSMUSG00000027306 and 108907, NUSAP1 and IDBG-646287 and ENSBTAG00000010774 and 616028
-
Gene info
-
Identity
-
Gene
-
Long gene namenucleolar and spindle associated protein 1
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2003-11-05
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data