Rabbit NRG3 antibody
-
Catalog number70R-6237
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCytokines & Growth Factors
-
ImmunogenNRG3 antibody was raised using the middle region of NRG3 corresponding to a region with amino acids TSINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPIIPSVGLEETCLQM
-
SpecificityNRG3 antibody was raised against the middle region of NRG3
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NRG3 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolNRG3, NRG3-AS1
-
Short nameRabbit NRG3 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal NRG3 antibody raised against the middle region of NRG3
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetneuregulin 3, HRG3 and pro-NRG3, NRG3 and IDBG-80642 and ENSG00000185737 and 10718, receptor tyrosine kinase binding, Extracellular, Nrg3 and IDBG-151248 and ENSMUSG00000041014 and 18183, NRG3 and IDBG-631178 and ENSBTAG00000009587 and 539977
-
Gene info
-
Identity
-
Gene
-
Long gene nameneuregulin 3
-
GenBank acession
-
Locus
-
Discovery year1999-03-19
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Neuregulins
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameNRG3 antisense RNA 1
-
Synonyms gene
-
Synonyms gene name
- chromosome 10 open reading frame 100
- NRG3 antisense RNA 1 (non-protein coding)
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2004-05-27
-
Entrez gene record
-
Classification
- Antisense RNAs
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data