Rabbit NR1H2 antibody

• Catalog number
  70R-1007
• Price
  Please ask
• Size
  100 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Cell Biology
• Immunogen
  NR1H2 antibody was raised using the middle region of NR1H2 corresponding to a region with amino acids  MIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAI
• Specificity
  NR1H2 antibody was raised against the middle region of NR1H2
• Cross Reactivity
  Human,Mouse,Rat,Dog
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NR1H2 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  NR1H2  
• Gene symbol
  NR1H2
• Short name
  Rabbit NR1H2 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal NR1H2 antibody raised against the middle region of NR1H2
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  nuclear receptor subfamily 1, group H, member 2, LXR-b and LXRB and NER and NER-I and RIP15 and UNR, NR1H2 and IDBG-64316 and ENSG00000131408 and 7376, ATPase binding, nuclei, Nr1h2 and IDBG-179265 and ENSMUSG00000060601 and 22260, BT.44371 and IDBG-641008 and ENSBTAG00000003264 and 509622

Gene info

• Identity
  HGNC:7965
• Gene
  NR1H2
• Long gene name
  nuclear receptor subfamily 1 group H member 2
• Synonyms gene
  • UNR
• Synonyms gene name
  • ubiquitously-expressed nuclear receptor
  • nuclear receptor subfamily 1, group H, member 2
• Synonyms
  • NER
  • NER-I
  • RIP15
  • LXR-b
  • LXRb
• Synonyms name
  • liver X receptor-beta
• GenBank acession
  • U14534
• Locus
  19q13.3
• Discovery year
  1994-09-19
• Entrez gene record
  7376
• Pubmed identfication
  • 7782080
  • 7971966
• Classification
  • Nuclear receptor subfamily 1 group H
• VEGA ID
  OTTHUMG00000183036

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products