Rabbit NOX1 antibody
-
Catalog number70R-7398
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenNOX1 antibody was raised using the C terminal of NOX1 corresponding to a region with amino acids STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
-
SpecificityNOX1 antibody was raised against the C terminal of NOX1
-
Cross ReactivityHuman,Dog
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NOX1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolNOX1
-
Short nameRabbit NOX1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal NOX1 antibody raised against the C terminal of NOX1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetNADPH oxidase 1, NOX1 and IDBG-79287 and ENSG00000007952 and 27035, NADP binding, Cell surfaces, Nox1 and IDBG-170699 and ENSMUSG00000031257 and 237038, NOX1 and IDBG-633329 and ENSBTAG00000016761 and 521681
-
Gene info
-
Identity
-
Gene
-
Long gene nameNADPH oxidase 1
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2000-03-24
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data