Rabbit NLRP1 antibody

• Catalog number
  70R-2731
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Cell Biology
• Immunogen
  NLRP1 antibody was raised using the N terminal of NLRP1 corresponding to a region with amino acids DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL
• Specificity
  NLRP1 antibody was raised against the N terminal of NLRP1
• Cross Reactivity
  Human,Mouse
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NLRP1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  NLRP1  
• Gene symbol
  NLRP1
• Short name
  Rabbit NLRP1 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal NLRP1 antibody raised against the N terminal of NLRP1
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  NLR family, pyrin domain containing 1, CARD7 and CIDED and CLR17.1 and DEFCAP and DEFCAP-L/S and NAC and NALP1 and PP1044 and SLEV1 and VAMAS1, NLRP1 and IDBG-21836 and ENSG00000091592 and 22861, protein domain specific binding, nuclei, NLRP1 and IDBG-633949 and ENSBTAG00000020433 and

Gene info

• Identity
  HGNC:14374
• Gene
  NLRP1
• Long gene name
  NLR family pyrin domain containing 1
• Synonyms gene
  • NALP1
  • SLEV1
• Synonyms gene name
  • NACHT, leucine rich repeat and PYD (pyrin domain) containing 1
  • systemic lupus erythematosus, vitiligo-related 1
• Synonyms
  • KIAA0926
  • DKFZp586O1822
  • CARD7
  • NAC
  • CLR17.1
  • DEFCAP
  • VAMAS1
• Synonyms name
  • nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 1
• GenBank acession
  • AB023143
• Locus
  17p13
• Discovery year
  2003-10-28
• Entrez gene record
  22861
• Pubmed identfication
  • 8781126
  • 12563287
  • 17377159
• RefSeq identity
  • NM_033004
• Classification
  • NLR family
  • Pyrin domain containing
  • Caspase recruitment domain containing
• VEGA ID
  OTTHUMG00000132419

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products