Rabbit NLGN4X antibody
-
Catalog number70R-6163
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaNeuroscience
-
ImmunogenNLGN4X antibody was raised using the middle region of NLGN4X corresponding to a region with amino acids ELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFE
-
SpecificityNLGN4X antibody was raised against the middle region of NLGN4X
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NLGN4X antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolNLGN4X
-
Short nameRabbit NLGN4X antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal NLGN4X antibody raised against the middle region of NLGN4X
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetneuroligin 4, X-linked, NLGN4X and IDBG-41664 and ENSG00000146938 and 57502, cell adhesion molecule binding, Cell surfaces
-
Gene info
-
Identity
-
Gene
-
Long gene nameneuroligin 4 X-linked
-
Synonyms gene
-
Synonyms gene name
- neuroligin 4
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2001-01-02
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Neuroligins
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data