Rabbit NEDD9 antibody
-
Catalog number70R-1701
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB, IHC
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenNEDD9 antibody was raised using the middle region of NEDD9 corresponding to a region with amino acids HPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLH
-
SpecificityNEDD9 antibody was raised against the middle region of NEDD9
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NEDD9 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolNEDD9
-
Short nameRabbit NEDD9 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal NEDD9 antibody raised against the middle region of NEDD9
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetneural precursor cell expressed, developmentally down-regulated 9, CAS-L and CAS2 and CASL and CASS2 and HEF1, NEDD9 and IDBG-61538 and ENSG00000111859 and 4739, protein binding, nuclei, Nedd9 and IDBG-146895 and ENSMUSG00000021365 and 18003, NEDD9 and IDBG-636135 and ENSBTAG00000006287 and
-
Gene info
-
Identity
-
Gene
-
Long gene nameneural precursor cell expressed, developmentally down-regulated 9
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1994-01-21
-
Entrez gene record
-
RefSeq identity
-
Classification
- Cas scaffold proteins
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data