Rabbit NDUFS1 antibody

• Catalog number
  70R-3459
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Proteases, Inhibitors, & Enzymes
• Immunogen
  NDUFS1 antibody was raised using the middle region of NDUFS1 corresponding to a region with amino acids TPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIE
• Specificity
  NDUFS1 antibody was raised against the middle region of NDUFS1
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NDUFS1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  NDUFS1  
• Gene symbol
  NDUFS1
• Short name
  Rabbit NDUFS1 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal NDUFS1 antibody raised against the middle region of NDUFS1
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa (NADH-coenzyme Q reductase), CI-75k and CI-75Kd and PRO1304, NDUFS1 and IDBG-79438 and ENSG00000023228 and 4719, oxidoreductase activity, Plasma membranes, Ndufs1 and IDBG-160282 and ENSMUSG00000025968 and 227197, NDUFS1 and IDBG-643401 and ENSBTAG00000021976 and 288380

Gene info

• Identity
  HGNC:7707
• Gene
  NDUFS1
• Long gene name
  NADH:ubiquinone oxidoreductase core subunit S1
• Synonyms gene name
  • NADH dehydrogenase (ubiquinone) Fe-S protein 1 (75kD) (NADH-coenzyme Q reductase)
  • NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa (NADH-coenzyme Q reductase)
• Synonyms
  • CI-75k
• Synonyms name
  • complex I 75kDa subunit
  • NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
• Locus
  2q33.3
• Discovery year
  1992-04-03
• Entrez gene record
  4719
• Pubmed identfication
  • 1935949
• RefSeq identity
  • NM_005006
• Classification
  • NADH:ubiquinone oxidoreductase core subunits
• VEGA ID
  OTTHUMG00000132892

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products