Rabbit NDRG1 antibody

• Catalog number
  70R-1121
• Price
  Please ask
• Size
  100 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Neuroscience
• Immunogen
  NDRG1 antibody was raised using the N terminal of NDRG1 corresponding to a region with amino acids MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCG
• Specificity
  NDRG1 antibody was raised against the N terminal of NDRG1
• Cross Reactivity
  Human,Mouse,Rat
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NDRG1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  NDRG1  
• Gene symbol
  NDRG1
• Short name
  Rabbit NDRG1 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal NDRG1 antibody raised against the N terminal of NDRG1
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  N-myc downstream regulated 1, CAP43 and CMT4D and DRG-1 and DRG1 and GC4 and HMSNL and NDR1 and NMSL and PROXY1 and RIT42 and RTP and TARG1 and TDD5, NDRG1 and IDBG-36420 and ENSG00000104419 and 10397, cadherin binding, nuclei, Ndrg1 and IDBG-146853 and ENSMUSG00000005125 and 17988, NDRG1 and IDBG-644056 and ENSBTAG00000000711 and 504499

Gene info

• Identity
  HGNC:7679
• Gene
  NDRG1
• Long gene name
  N-myc downstream regulated 1
• Synonyms gene
  • CAP43
• Synonyms
  • DRG1
  • RTP
  • TDD5
  • NDR1
• GenBank acession
  • X92845
• Locus
  8q24.22
• Discovery year
  1998-12-23
• Entrez gene record
  10397
• Pubmed identfication
  • 9251681
  • 8939898
  • 18455888
• Classification
  • NDRG family
• VEGA ID
  OTTHUMG00000164441
• Locus Specific Databases
  • Inherited Peripheral Neuropathies Mutation Database
  • LRG_258

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products