Rabbit MYBPH antibody

• Catalog number
  70R-6049
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Cell Biology
• Immunogen
  MYBPH antibody was raised using the N terminal of MYBPH corresponding to a region with amino acids LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP
• Specificity
  MYBPH antibody was raised against the N terminal of MYBPH
• Cross Reactivity
  Human,Mouse,Rat
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MYBPH antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  MYBPH  
• Gene symbol
  MYBPH
• Short name
  Rabbit MYBPH antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal MYBPH antibody raised against the N terminal of MYBPH
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  myosin binding protein H, MYBPH and IDBG-105930 and ENSG00000133055 and 4608, structural constituent of muscle, multiple, Mybph and IDBG-193443 and ENSMUSG00000042451 and 53311, BT.54476 and IDBG-628575 and ENSBTAG00000011465 and 510169

Gene info

• Identity
  HGNC:7552
• Gene
  MYBPH
• Long gene name
  myosin binding protein H
• Synonyms gene name
  • myosin-binding protein H
• GenBank acession
  • BC044226
• Locus
  1q32.1
• Discovery year
  1993-06-18
• Entrez gene record
  4608
• Pubmed identfication
  • 8486381
• RefSeq identity
  • NM_004997
• Classification
  • I-set domain containing
  • Myosin binding proteins
• VEGA ID
  OTTHUMG00000042121

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products