Rabbit MYBPC2 antibody
-
Catalog number70R-6055
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenMYBPC2 antibody was raised using the N terminal of MYBPC2 corresponding to a region with amino acids KEAPPEDQSPTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPT
-
SpecificityMYBPC2 antibody was raised against the N terminal of MYBPC2
-
Cross ReactivityHuman,Mouse
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MYBPC2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolMYBPC2
-
Short nameRabbit MYBPC2 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal MYBPC2 antibody raised against the N terminal of MYBPC2
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetmyosin binding protein C, fast type, MYBPC and MYBPCF, MYBPC2 and IDBG-64489 and ENSG00000086967 and 4606, structural constituent of muscle, Cytoplasm, Mybpc2 and IDBG-178931 and ENSMUSG00000038670 and 233199, MYBPC2 and IDBG-641047 and ENSBTAG00000020080 and
-
Gene info
-
Identity
-
Gene
-
Long gene namemyosin binding protein C2
-
Synonyms gene name
- myosin-binding protein C, fast-type
-
Synonyms
-
Synonyms name
-
Locus
-
Discovery year1993-12-15
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- I-set domain containing
- Myosin binding proteins
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data