Rabbit MSH2 antibody
-
Catalog number70R-5689
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCancer
-
ImmunogenMSH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDG
-
SpecificityNA
-
Cross ReactivityHuman,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MSH2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolMSH2-OT1, MSH2
-
Short nameRabbit MSH2 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal MSH2 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetmutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli), COCA1 and FCC1 and HNPCC and HNPCC1 and LCFS2, MSH2 and IDBG-50900 and ENSG00000095002 and 4436, ADP binding, nuclei, Msh2 and IDBG-201483 and ENSMUSG00000024151 and 17685, MSH2 and IDBG-633627 and ENSBTAG00000002742 and 533115
-
Gene info
-
Identity
-
Gene
-
Long gene nameMSH2 overlapping transcript 1
-
Locus
-
Discovery year2019-08-15
-
Entrez gene record
-
RefSeq identity
-
Classification
- Overlapping transcripts
Gene info
-
Identity
-
Gene
-
Long gene namemutS homolog 2
-
Synonyms gene
-
Synonyms gene name
- mutS (E. coli) homolog 2 (colon cancer, nonpolyposis type 1)
- mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli)
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1993-07-28
-
Entrez gene record
-
Pubmed identfication
-
Classification
- MutS homologs
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data