Rabbit MMP9 antibody
-
Catalog number70R-1574
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDifferentiation & Development
-
ImmunogenMMP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids VAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTR
-
SpecificityNA
-
Cross ReactivityHuman, Mouse, Rat, Dog, ZebraFish
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MMP9 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolMMP9
-
Short nameRabbit MMP9 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal MMP9 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetmatrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase), CLG4B and GELB and MANDP2 and MMP-9, MMP9 and IDBG-78722 and ENSG00000100985 and 4318, identical protein binding, Extracellular, Mmp9 and IDBG-212451 and ENSMUSG00000017737 and 17395, MMP9 and IDBG-642990 and ENSBTAG00000020676 and 282871
-
Gene info
-
Identity
-
Gene
-
Long gene namematrix metallopeptidase 9
-
Synonyms gene
-
Synonyms gene name
- matrix metalloproteinase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)
-
Locus
-
Discovery year1990-03-14
-
Entrez gene record
-
Pubmed identfication
-
Classification
- M10 matrix metallopeptidases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data