Rabbit MMP9 antibody

• Catalog number
  70R-1574
• Price
  Please ask
• Size
  100 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Differentiation & Development
• Immunogen
  MMP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids VAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTR
• Specificity
  NA
• Cross Reactivity
  Human, Mouse, Rat, Dog, ZebraFish
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MMP9 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  MMP9  
• Gene symbol
  MMP9
• Short name
  Rabbit MMP9 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal MMP9 antibody
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase), CLG4B and GELB and MANDP2 and MMP-9, MMP9 and IDBG-78722 and ENSG00000100985 and 4318, identical protein binding, Extracellular, Mmp9 and IDBG-212451 and ENSMUSG00000017737 and 17395, MMP9 and IDBG-642990 and ENSBTAG00000020676 and 282871

Gene info

• Identity
  HGNC:7176
• Gene
  MMP9
• Long gene name
  matrix metallopeptidase 9
• Synonyms gene
  • CLG4B
• Synonyms gene name
  • matrix metalloproteinase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)
• Locus
  20q13.12
• Discovery year
  1990-03-14
• Entrez gene record
  4318
• Pubmed identfication
  • 2158484
• Classification
  • M10 matrix metallopeptidases
• VEGA ID
  OTTHUMG00000033044

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products