Rabbit MLH1 antibody
-
Catalog number70R-5690
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCancer
-
ImmunogenMLH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSK
-
SpecificityNA
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MLH1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolMLH1
-
Short nameRabbit MLH1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal MLH1 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetmutL homolog 1, colon cancer, nonpolyposis type 2 (E. coli), COCA2 and FCC2 and hMLH1 and HNPCC and HNPCC2, MLH1 and IDBG-24600 and ENSG00000076242 and 4292, structure-specific DNA binding, nuclei, Mlh1 and IDBG-202755 and ENSMUSG00000032498 and 17350, MLH1 and IDBG-644253 and ENSBTAG00000016758 and 533652
-
Gene info
-
Identity
-
Gene
-
Long gene namemutL homolog 1
-
Synonyms gene
-
Synonyms gene name
- mutL (E. coli) homolog 1 (colon cancer, nonpolyposis type 2)
- mutL homolog 1, colon cancer, nonpolyposis type 2 (E. coli)
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1993-11-24
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- MutL homologs
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data