Rabbit MLF1 antibody
-
Catalog number70R-2146
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCancer
-
ImmunogenMLF1 antibody was raised using the N terminal of MLF1 corresponding to a region with amino acids GRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQ
-
SpecificityMLF1 antibody was raised against the N terminal of MLF1
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MLF1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolMLF1, MLF1-DT
-
Short nameRabbit MLF1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal MLF1 antibody raised against the N terminal of MLF1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetmyeloid leukemia factor 1, MLF1 and IDBG-63091 and ENSG00000178053 and 4291, protein domain specific binding, nuclei, Mlf1 and IDBG-150128 and ENSMUSG00000048416 and 17349, MLF1 and IDBG-637188 and ENSBTAG00000004126 and 533379
-
Gene info
-
Identity
-
Gene
-
Long gene namemyeloid leukemia factor 1
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1994-08-29
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
-
Locus Specific Databases
Gene info
-
Identity
-
Gene
-
Long gene nameMLF1 divergent transcript
-
Locus
-
Discovery year2021-06-21
-
Entrez gene record
-
RefSeq identity
-
Classification
- Divergent transcripts
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data